Araha.1718s0003.3.p (PRGDB28361)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB28361	Araha.1718s0003.3.p	N	putative	NBS, TM	Arabidopsis halleri

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.1718s0003.4.p	Arabidopsis halleri	99.9	190	1e-138
Araha.1718s0003.2.p	Arabidopsis halleri	99	192	1e-136
Araha.1718s0003.1.p	Arabidopsis halleri	99	192	1e-136
874982	Arabidopsis lyrata	93.8	192	9e-126
AT2G16790.2	Arabidopsis thaliana	94.6	186	6e-125
AT2G16790.1	Arabidopsis thaliana	93.6	188	4e-123
Bo9g024250.1	Brassica oleracea	89.2	186	4e-119
Cagra.0839s0003.1.p	Conradina grandiflora	91.7	180	5e-117
Phvul.003G054200.1	Phaseolus vulgaris	55	180	3e-65
Aco015996.1	Ananas comosus	51.6	188	3e-63

Showing 1 to 10 of 21 entries

Protein sequence

MSANNDGKVIVIMGVSGAGKSTIGKMLGKALSCDFLDADDFHSLSNRDKMRQGIALSDEDRMPWLEKIQE
SLRKRLLNEETVVLACSSLRKQYREILRGSDPDYKPGSYTSCKVKFVLLEGNAEVIAARLQKRASEEEHF
MPLTLLQSQFDLLQADDECEKIFKISVVLSPQVIVNTIHEMLGNSLREGI