Araha.1718s0003.2.p (PRGDB28363)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB28363	Araha.1718s0003.2.p	N	putative	NBS, TM	Arabidopsis halleri

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Araha.1718s0003.1.p	Arabidopsis halleri	99.9	192	3e-140
Araha.1718s0003.4.p	Arabidopsis halleri	99	192	1e-136
Araha.1718s0003.3.p	Arabidopsis halleri	99	192	1e-136
874982	Arabidopsis lyrata	94.3	192	1e-128
AT2G16790.1	Arabidopsis thaliana	94.7	188	1e-126
AT2G16790.2	Arabidopsis thaliana	93.6	188	5e-123
Cagra.0839s0003.1.p	Conradina grandiflora	89.4	188	1e-119
Bo9g024250.1	Brassica oleracea	88.3	188	2e-117
Aco015996.1	Ananas comosus	51.6	188	2e-65
Phvul.003G054200.1	Phaseolus vulgaris	54.4	182	2e-63

Showing 1 to 10 of 21 entries

Protein sequence

MSANNDVTGKVIVIMGVSGAGKSTIGKMLGKALSCDFLDADDFHSLSNRDKMRQGIALSDEDRMPWLEKI
QESLRKRLLNEETVVLACSSLRKQYREILRGSDPDYKPGSYTSCKVKFVLLEGNAEVIAARLQKRASEEE
HFMPLTLLQSQFDLLQADDECEKIFKISVVLSPQVIVNTIHEMLGNSLREGI