Phvul.003G054200.1 (PRGDB2107943)

Gene information

PRGdb ID	Gene name	Class	Gene type	Domain types	Species
PRGDB2107943	Phvul.003G054200.1	N	putative	NBS, TM	Phaseolus vulgaris

Protein domain view
Position :
0
Zoom :
x 1
Show help

Blast search results

Show entries

Search:

Gene name hit	Species hit	Identity (%)	Length (bp)	E-value
Cagra.0839s0003.1.p	Conradina grandiflora	55.4	175	4e-66
Bo9g024250.1	Brassica oleracea	52.5	179	1e-65
AT2G16790.2	Arabidopsis thaliana	53.6	179	2e-65
874982	Arabidopsis lyrata	54.1	181	3e-65
Araha.1718s0003.4.p	Arabidopsis halleri	55	180	3e-65
Araha.1718s0003.3.p	Arabidopsis halleri	55	180	3e-65
AT2G16790.1	Arabidopsis thaliana	53	181	2e-63
Araha.1718s0003.2.p	Arabidopsis halleri	54.4	182	2e-63
Araha.1718s0003.1.p	Arabidopsis halleri	54.4	182	2e-63
Aco015996.1	Ananas comosus	51.1	182	3e-60

Showing 1 to 10 of 21 entries

Protein sequence

MASNDGAVIVVMGVSGAGKTTIGRRLEKEMQYKYLDADDFHSELNKEKMRMGIPLTDEDRMPWLKALRDV
INEYLDNKKGLILGCSALKNQYREMLRSGYPAYKLGTYASPVNFILLDAPAEVLSVRVKARAAEGKHYMP
ASLLQSQIDLLQVDHCEGILKVDATLIPQTIVNTILNMLHFQGCFHHDCIEFH